SCOPe 2.08: Domain d2fo1a1: 2fo1 A:542-660

Lineage for d2fo1a1 (2fo1 A:542-660)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.18: E set domains [81296] (27 families)
   "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies

5. Family b.1.18.1: NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain [81279] (8 proteins)
   subgroup of the larger IPT/TIG domain family

6. Protein DNA-binding protein LAG-1 (CSL) [110052] (1 species)

7. Species Nematode (Caenorhabditis elegans) [TaxId:6239] [110053] (4 PDB entries)
   Uniprot Q9TYY1 195-660

8. Domain d2fo1a1: 2fo1 A:542-660 [133865]
   Other proteins in same PDB: d2fo1a2, d2fo1a3, d2fo1d1, d2fo1e1
   automatically matched to d1ttua1
   protein/DNA complex

Details for d2fo1a1

PDB Entry: 2fo1, 3.12 Å

PDB Description: Crystal Structure of the CSL-Notch-Mastermind ternary complex bound to DNA

PDB Compounds: (A:) Lin-12 and glp-1 phenotype protein 1, isoform b

SCOPe Domain Sequences for d2fo1a1:

Sequence; same for both SEQRES and ATOM records:

>d2fo1a1 b.1.18.1 (A:542-660) DNA-binding protein LAG-1 (CSL) {Nematode (Caenorhabditis elegans) [TaxId: 6239]}
dkaeyrffeamgqvanpispcpvvgslevdghgeasrvelhgrdfkpnlkvwfgatpvet
tfrseeslhcsippvsqvrneqthwmftnrttgdvevpislvrddgvvyssgltfsyks

Timeline for d2fo1a1:

• d2fo1a1 first appeared in SCOP 1.73
  
• d2fo1a1 appears in SCOPe 2.07