![]() | Class b: All beta proteins [48724] (165 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.18: E set domains [81296] (20 families) ![]() "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies |
![]() | Family b.1.18.1: NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain [81279] (7 proteins) subgroup of the larger IPT/TIG domain family |
![]() | Protein DNA-binding protein LAG-1 (CSL) [110052] (1 species) |
![]() | Species Caenorhabditis elegans [TaxId:6239] [110053] (2 PDB entries) |
![]() | Domain d2fo1a1: 2fo1 A:542-660 [133865] Other proteins in same PDB: d2fo1a2, d2fo1a3 automatically matched to d1ttua1 |
PDB Entry: 2fo1 (more details), 3.12 Å
SCOP Domain Sequences for d2fo1a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2fo1a1 b.1.18.1 (A:542-660) DNA-binding protein LAG-1 (CSL) {Caenorhabditis elegans [TaxId: 6239]} dkaeyrffeamgqvanpispcpvvgslevdghgeasrvelhgrdfkpnlkvwfgatpvet tfrseeslhcsippvsqvrneqthwmftnrttgdvevpislvrddgvvyssgltfsyks
Timeline for d2fo1a1: