| Class a: All alpha proteins [46456] (284 folds) |
| Fold a.45: GST C-terminal domain-like [47615] (1 superfamily) core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix |
Superfamily a.45.1: GST C-terminal domain-like [47616] (2 families) ![]() this domains follows the thioredoxin-like N-terminal domain |
| Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (18 proteins) |
| Protein Hypothetical protein AGR_pAT_752p/Atu5508 [140558] (1 species) putative glutathione S-transferase |
| Species Agrobacterium tumefaciens [TaxId:358] [140559] (1 PDB entry) Uniprot Q7D2W7 88-236 |
| Domain d2fnob1: 2fno B:88-236 [133823] Other proteins in same PDB: d2fnoa2, d2fnob2 automatically matched to 2FNO A:88-236 complexed with scn |
PDB Entry: 2fno (more details), 2 Å
SCOPe Domain Sequences for d2fnob1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2fnob1 a.45.1.1 (B:88-236) Hypothetical protein AGR_pAT_752p/Atu5508 {Agrobacterium tumefaciens [TaxId: 358]}
lpatvegrtlsakivndandvldeltlnggremwtpekwqefvprlqkwirifadtgarn
glsaasgfmlgtekigvadivtailwttvadrfpaikgiiedtspiiwglsrrvvatapl
aalnsksfeeygnaycggeiekslrkvas
Timeline for d2fnob1: