![]() | Class a: All alpha proteins [46456] (285 folds) |
![]() | Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
![]() | Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (85 families) ![]() contains a small beta-sheet (wing) |
![]() | Family a.4.5.11: Helicase DNA-binding domain [46819] (4 proteins) follows the extended AAA-ATPase domain |
![]() | Protein Hypothetical protein SSO1545, C-terminal domain [140261] (1 species) |
![]() | Species Sulfolobus solfataricus [TaxId:2287] [140262] (1 PDB entry) Uniprot Q97Y08 284-356 |
![]() | Domain d2fnab1: 2fna B:284-356 [133811] Other proteins in same PDB: d2fnaa2, d2fnab2 automated match to d2fnaa1 complexed with adp, edo, mg |
PDB Entry: 2fna (more details), 2 Å
SCOPe Domain Sequences for d2fnab1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2fnab1 a.4.5.11 (B:284-356) Hypothetical protein SSO1545, C-terminal domain {Sulfolobus solfataricus [TaxId: 2287]} reiarkrylnimrtlskcgkwsdvkraleleegieisdseiynyltqltkhswiikegek ycpseplislafs
Timeline for d2fnab1: