SCOP 1.73: Domain d2fnab1: 2fna B:284-356

Lineage for d2fnab1 (2fna B:284-356)

1. Root: SCOP 1.73

2. Class a: All alpha proteins [46456] (258 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (68 families)
   contains a small beta-sheet (wing)

5. Family a.4.5.11: Helicase DNA-binding domain [46819] (4 proteins)
   follows the extended AAA-ATPase domain

6. Protein Hypothetical protein SSO1545, C-terminal domain [140261] (1 species)

7. Species Sulfolobus solfataricus [TaxId:2287] [140262] (1 PDB entry)

8. Domain d2fnab1: 2fna B:284-356 [133811]
   Other proteins in same PDB: d2fnaa2, d2fnab2
   automatically matched to 2FNA A:284-356
   complexed with adp, edo, mg

Details for d2fnab1

PDB Entry: 2fna, 2 Å

PDB Description: Crystal structure of an archaeal aaa+ atpase (sso1545) from sulfolobus solfataricus p2 at 2.00 A resolution

PDB Compounds: (B:) conserved hypothetical protein

SCOP Domain Sequences for d2fnab1:

Sequence; same for both SEQRES and ATOM records:

>d2fnab1 a.4.5.11 (B:284-356) Hypothetical protein SSO1545, C-terminal domain {Sulfolobus solfataricus [TaxId: 2287]}
reiarkrylnimrtlskcgkwsdvkraleleegieisdseiynyltqltkhswiikegek
ycpseplislafs

Timeline for d2fnab1:

• d2fnab1 is new in SCOP 1.73
  
• d2fnab1 appears in SCOP 1.75
  
• d2fnab1 appears in the current release, SCOPe 2.08