Lineage for d2fm5c1 (2fm5 C:86-412)

  1. Root: SCOPe 2.01
  2. 901761Class a: All alpha proteins [46456] (284 folds)
  3. 927815Fold a.211: HD-domain/PDEase-like [109603] (1 superfamily)
    multihelical; consists of two different alpha-helical bundles
  4. 927816Superfamily a.211.1: HD-domain/PDEase-like [109604] (6 families) (S)
  5. 927893Family a.211.1.2: PDEase [48548] (7 proteins)
    Pfam PF00233; multihelical; can be divided into three subdomains
  6. 927926Protein Catalytic domain of cyclic nucleotide phosphodiesterase pde4d [89151] (1 species)
  7. 927927Species Human (Homo sapiens) [TaxId:9606] [89152] (25 PDB entries)
    Uniprot Q08499 388-713
  8. 927966Domain d2fm5c1: 2fm5 C:86-412 [133763]
    automatically matched to d1oyna_
    complexed with m99, mg, zn

Details for d2fm5c1

PDB Entry: 2fm5 (more details), 2.03 Å

PDB Description: Crystal structure of PDE4D2 in complex with inhibitor L-869299
PDB Compounds: (C:) cAMP-specific 3',5'-cyclic phosphodiesterase 4D

SCOPe Domain Sequences for d2fm5c1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2fm5c1 a.211.1.2 (C:86-412) Catalytic domain of cyclic nucleotide phosphodiesterase pde4d {Human (Homo sapiens) [TaxId: 9606]}
teqedvlakeledvnkwglhvfriaelsgnrpltvimhtifqerdllktfkipvdtlity
lmtledhyhadvayhnnihaadvvqsthvllstpaleavftdleilaaifasaihdvdhp
gvsnqflintnselalmyndssvlenhhlavgfkllqeencdifqnltkkqrqslrkmvi
divlatdmskhmnlladlktmvetkkvtssgvllldnysdriqvlqnmvhcadlsnptkp
lqlyrqwtdrimeeffrqgdrerergmeispmcdkhnasveksqvgfidyivhplwetwa
dlvhpdaqdildtlednrewyqstipq

SCOPe Domain Coordinates for d2fm5c1:

Click to download the PDB-style file with coordinates for d2fm5c1.
(The format of our PDB-style files is described here.)

Timeline for d2fm5c1: