![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies) main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest |
![]() | Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) ![]() |
![]() | Family c.67.1.1: AAT-like [53384] (17 proteins) |
![]() | Protein Low-specificity threonine aldolase [64123] (2 species) |
![]() | Species Thermotoga maritima [TaxId:2336] [64124] (5 PDB entries) |
![]() | Domain d2fm1b_: 2fm1 B: [133757] Other proteins in same PDB: d2fm1d3 automated match to d1jg8a_ complexed with ca, cl, gol, na |
PDB Entry: 2fm1 (more details), 2.25 Å
SCOPe Domain Sequences for d2fm1b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2fm1b_ c.67.1.1 (B:) Low-specificity threonine aldolase {Thermotoga maritima [TaxId: 2336]} midlrsdtvtkpteemrkamaqaevgddvygedptinelerlaaetfgkeaalfvpsgtm gnqvsimahtqrgdevileadshifwyevgamavlsgvmphpvpgkngamdpddvrkair prnihfprtsliaienthnrsggrvvplenikeictiakehginvhidgarifnasiasg vpvkeyagyadsvmfclskglcapvgsvvvgdrdfierarkarkmlgggmrqagvlaaag iialtkmvdrlkedhenarflalklkeigysvnpedvktnmvilrtdnlkvnahgfieal rnsgvlanavsdteirlvthkdvsrndieealnifeklfrkfs
Timeline for d2fm1b_:
![]() Domains from other chains: (mouse over for more information) d2fm1a_, d2fm1c_, d2fm1d2, d2fm1d3 |