SCOPe 2.08: Domain d2fm1c_: 2fm1 C:

Lineage for d2fm1c_ (2fm1 C:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
   main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest

4. Superfamily c.67.1: PLP-dependent transferases [53383] (10 families)

5. Family c.67.1.1: AAT-like [53384] (17 proteins)

6. Protein Low-specificity threonine aldolase [64123] (2 species)

7. Species Thermotoga maritima [TaxId:2336] [64124] (5 PDB entries)

8. Domain d2fm1c_: 2fm1 C: [133758]
   Other proteins in same PDB: d2fm1d3
   automated match to d1jg8a_
   complexed with ca, cl, gol, na

Details for d2fm1c_

PDB Entry: 2fm1, 2.25 Å

PDB Description: Crystal structure of L-ALLO-threonine aldolase (tm1744) from Thermotoga maritima at 2.25 A resolution

PDB Compounds: (C:) L-allo-threonine aldolase

SCOPe Domain Sequences for d2fm1c_:

Sequence; same for both SEQRES and ATOM records:

>d2fm1c_ c.67.1.1 (C:) Low-specificity threonine aldolase {Thermotoga maritima [TaxId: 2336]}
midlrsdtvtkpteemrkamaqaevgddvygedptinelerlaaetfgkeaalfvpsgtm
gnqvsimahtqrgdevileadshifwyevgamavlsgvmphpvpgkngamdpddvrkair
prnihfprtsliaienthnrsggrvvplenikeictiakehginvhidgarifnasiasg
vpvkeyagyadsvmfclskglcapvgsvvvgdrdfierarkarkmlgggmrqagvlaaag
iialtkmvdrlkedhenarflalklkeigysvnpedvktnmvilrtdnlkvnahgfieal
rnsgvlanavsdteirlvthkdvsrndieealnifeklfrkfs

Timeline for d2fm1c_:

• d2fm1c_ first appeared in SCOP 1.73, called d2fm1c1
  
• d2fm1c_ appears in SCOPe 2.07