![]() | Class c: Alpha and beta proteins (a/b) [51349] (141 folds) |
![]() | Fold c.67: PLP-dependent transferases [53382] (1 superfamily) main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest |
![]() | Superfamily c.67.1: PLP-dependent transferases [53383] (8 families) ![]() |
![]() | Family c.67.1.1: AAT-like [53384] (16 proteins) |
![]() | Protein Low-specificity threonine aldolase [64123] (2 species) |
![]() | Species Thermotoga maritima [TaxId:2336] [64124] (5 PDB entries) |
![]() | Domain d2fm1b1: 2fm1 B:1-343 [133757] automatically matched to d1jg8d_ complexed with ca, cl, gol, na |
PDB Entry: 2fm1 (more details), 2.25 Å
SCOP Domain Sequences for d2fm1b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2fm1b1 c.67.1.1 (B:1-343) Low-specificity threonine aldolase {Thermotoga maritima [TaxId: 2336]} midlrsdtvtkpteemrkamaqaevgddvygedptinelerlaaetfgkeaalfvpsgtm gnqvsimahtqrgdevileadshifwyevgamavlsgvmphpvpgkngamdpddvrkair prnihfprtsliaienthnrsggrvvplenikeictiakehginvhidgarifnasiasg vpvkeyagyadsvmfclskglcapvgsvvvgdrdfierarkarkmlgggmrqagvlaaag iialtkmvdrlkedhenarflalklkeigysvnpedvktnmvilrtdnlkvnahgfieal rnsgvlanavsdteirlvthkdvsrndieealnifeklfrkfs
Timeline for d2fm1b1: