Lineage for d2fl0c_ (2fl0 C:)

  1. Root: SCOPe 2.08
  2. Class a: All alpha proteins [46456] (290 folds)
  3. Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. Superfamily a.25.1: Ferritin-like [47240] (10 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. Family a.25.1.1: Ferritin [47241] (10 proteins)
  6. Protein automated matches [190041] (33 species)
    not a true protein
  7. Species Azotobacter vinelandii [TaxId:354] [186762] (3 PDB entries)
  8. Domain d2fl0c_: 2fl0 C: [133698]
    automated match to d1bcfa_
    complexed with fe2, hem, mg

Details for d2fl0c_

PDB Entry: 2fl0 (more details), 2.7 Å

PDB Description: Oxidized (All ferric) form of the Azotobacter vinelandii bacterioferritin
PDB Compounds: (C:) bacterioferritin

SCOPe Domain Sequences for d2fl0c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2fl0c_ a.25.1.1 (C:) automated matches {Azotobacter vinelandii [TaxId: 354]}
mkgdkiviqhlnkilgneliainqyflharmyedwgleklgkheyhesidemkhadklik
rilfleglpnlqelgklligehtkemlecdlkleqaglpdlkaaiaycesvgdyasrell
edileseedhidwletqldlidkiglenylqsqmd

SCOPe Domain Coordinates for d2fl0c_ are not available.

Timeline for d2fl0c_:

View in 3D
Domains from other chains:
(mouse over for more information)
d2fl0a_, d2fl0b_, d2fl0d_, d2fl0e_, d2fl0f_, d2fl0g_, d2fl0h_