Lineage for d2fk0e1 (2fk0 E:11-324)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 662496Fold b.19: Viral protein domain [49817] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll; form trimers
  4. 662497Superfamily b.19.1: Viral protein domain [49818] (3 families) (S)
    forms homotrimers
  5. 662542Family b.19.1.2: Influenza hemagglutinin headpiece [49823] (1 protein)
  6. 662543Protein Hemagglutinin [49824] (1 species)
    includes rudiment esterase domain
  7. 662544Species Influenza A virus, different strains [TaxId:11320] [49825] (39 PDB entries)
  8. 662639Domain d2fk0e1: 2fk0 E:11-324 [133632]
    Other proteins in same PDB: d2fk0b1, d2fk0d1, d2fk0f1, d2fk0h1, d2fk0j1, d2fk0l1, d2fk0n1, d2fk0p1, d2fk0r1
    automatically matched to 2FK0 A:11-324
    complexed with bma, nag

Details for d2fk0e1

PDB Entry: 2fk0 (more details), 2.95 Å

PDB Description: crystal structure of a h5n1 influenza virus hemagglutinin.
PDB Compounds: (E:) Hemagglutinin

SCOP Domain Sequences for d2fk0e1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2fk0e1 b.19.1.2 (E:11-324) Hemagglutinin {Influenza A virus, different strains [TaxId: 11320]}
dqicigyhannsteqvdtimeknvtvthaqdilekkhngklcdldgvkplilrdcsvagw
llgnpmcdefinvpewsyivekanpvndlcypgdfndyeelkhllsrinhfekiqiipks
swssheaslgvssacpyqgkssffrnvvwlikknstyptikrsynntnqedllvlwgihh
pndaaeqtklyqnpttyisvgtstlnqrlvpriatrskvngqsgrmeffwtilkpndain
fesngnfiapeyaykivkkgdstimkseleygncntkcqtpmgainssmpfhnihpltig
ecpkyvksnrlvlatglrnsp

SCOP Domain Coordinates for d2fk0e1:

Click to download the PDB-style file with coordinates for d2fk0e1.
(The format of our PDB-style files is described here.)

Timeline for d2fk0e1: