Lineage for d2fk0h1 (2fk0 H:1-175)

  1. Root: SCOP 1.73
  2. 752207Class h: Coiled coil proteins [57942] (7 folds)
  3. 753258Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
    core: trimeric coiled coil
  4. 753259Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (1 family) (S)
  5. 753260Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (1 protein)
  6. 753261Protein Influenza hemagglutinin (stalk) [58066] (2 species)
    trimer
  7. 753262Species Influenza A virus, different strains [TaxId:11320] [58067] (38 PDB entries)
  8. 753364Domain d2fk0h1: 2fk0 H:1-175 [133635]
    Other proteins in same PDB: d2fk0a1, d2fk0c1, d2fk0e1, d2fk0g1, d2fk0i1, d2fk0k1, d2fk0m1, d2fk0o1, d2fk0q1
    automatically matched to 2FK0 B:1-175
    complexed with bma, nag

Details for d2fk0h1

PDB Entry: 2fk0 (more details), 2.95 Å

PDB Description: Crystal Structure of a H5N1 influenza virus hemagglutinin.
PDB Compounds: (H:) Hemagglutinin

SCOP Domain Sequences for d2fk0h1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2fk0h1 h.3.1.1 (H:1-175) Influenza hemagglutinin (stalk) {Influenza A virus, different strains [TaxId: 11320]}
glfgaiagfieggwqgmvdgwygyhhsneqgsgyaadkestqkaidgvtnkvnsiidkmn
tqfeavgrefnnlerrienlnkkmedgfldvwtynaellvlmenertldfhdsnvknlyd
kvrlqlrdnakelgngcfefyhkcdnecmesvrngtydypqyseearlkreeiss

SCOP Domain Coordinates for d2fk0h1:

Click to download the PDB-style file with coordinates for d2fk0h1.
(The format of our PDB-style files is described here.)

Timeline for d2fk0h1: