Lineage for d2fk0e2 (2fk0 E:11-324)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2040266Fold b.19: Viral protein domain [49817] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll; form trimers
  4. 2040267Superfamily b.19.1: Viral protein domain [49818] (4 families) (S)
    forms homotrimers
  5. 2040314Family b.19.1.2: Influenza hemagglutinin headpiece [49823] (2 protein domains)
  6. 2040710Protein automated matches [190291] (25 species)
    not a true protein
  7. 2040766Species Influenza a virus (a/viet nam/1203/2004(h5n1)) [TaxId:284218] [187096] (1 PDB entry)
  8. 2040768Domain d2fk0e2: 2fk0 E:11-324 [133632]
    Other proteins in same PDB: d2fk0a1, d2fk0a2, d2fk0b1, d2fk0b2, d2fk0c3, d2fk0d2, d2fk0d3, d2fk0e3, d2fk0f2, d2fk0f3, d2fk0g3, d2fk0h2, d2fk0h3, d2fk0i3, d2fk0j2, d2fk0j3, d2fk0k3, d2fk0l2, d2fk0l3, d2fk0m3, d2fk0n2, d2fk0n3, d2fk0o3, d2fk0p2, d2fk0p3, d2fk0q3, d2fk0r2, d2fk0r3
    automated match to d1jsma_

Details for d2fk0e2

PDB Entry: 2fk0 (more details), 2.95 Å

PDB Description: Crystal Structure of a H5N1 influenza virus hemagglutinin.
PDB Compounds: (E:) Hemagglutinin

SCOPe Domain Sequences for d2fk0e2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2fk0e2 b.19.1.2 (E:11-324) automated matches {Influenza a virus (a/viet nam/1203/2004(h5n1)) [TaxId: 284218]}
dqicigyhannsteqvdtimeknvtvthaqdilekkhngklcdldgvkplilrdcsvagw
llgnpmcdefinvpewsyivekanpvndlcypgdfndyeelkhllsrinhfekiqiipks
swssheaslgvssacpyqgkssffrnvvwlikknstyptikrsynntnqedllvlwgihh
pndaaeqtklyqnpttyisvgtstlnqrlvpriatrskvngqsgrmeffwtilkpndain
fesngnfiapeyaykivkkgdstimkseleygncntkcqtpmgainssmpfhnihpltig
ecpkyvksnrlvlatglrnsp

SCOPe Domain Coordinates for d2fk0e2:

Click to download the PDB-style file with coordinates for d2fk0e2.
(The format of our PDB-style files is described here.)

Timeline for d2fk0e2: