SCOPe 2.01: Domain d2fjwa_: 2fjw A:

Lineage for d2fjwa_ (2fjw A:)

1. Root: SCOPe 2.01

2. Class e: Multi-domain proteins (alpha and beta) [56572] (66 folds)

3. Fold e.8: DNA/RNA polymerases [56671] (1 superfamily)
   divided into morphological domains including "palm", "thumb" and "fingers"; the catalytic "palm" domain is conserved to all members

4. Superfamily e.8.1: DNA/RNA polymerases [56672] (6 families)
   "palm" domain has a ferredoxin-like fold, related to that of an adenylyl cyclase domain

5. Family e.8.1.2: Reverse transcriptase [56686] (3 proteins)

6. Protein MMLV reverse transcriptase [56687] (1 species)

7. Species Moloney murine leukemia virus, MoMLV [TaxId:11801] [56688] (22 PDB entries)
   Uniprot P03355 RE 144-594

8. Domain d2fjwa_: 2fjw A: [133624]
   automated match to d1d0eb_
   protein/DNA complex

Details for d2fjwa_

PDB Entry: 2fjw, 1.95 Å

PDB Description: d(cttgaatgcattcaag) in complex with mmlv rt catalytic fragment

PDB Compounds: (A:) reverse transcriptase

SCOPe Domain Sequences for d2fjwa_:

Sequence; same for both SEQRES and ATOM records:

>d2fjwa_ e.8.1.2 (A:) MMLV reverse transcriptase {Moloney murine leukemia virus, MoMLV [TaxId: 11801]}
twlsdfpqawaetggmglavrqapliiplkatstpvsikqypmsqearlgikphiqrlld
qgilvpcqspwntpllpvkkpgtndyrpvqdlrevnkrvedihptvpnpynllsglppsh
qwytvldlkdaffclrlhptsqplfafewrdpemgisgqltwtrlpqgfknsptlfdeal
hrdladfriqhpdlillqyvddlllaatseldcqqgtrallqtlgnlgyrasakkaqicq
kqvkylgyllkegqr

Timeline for d2fjwa_:

• d2fjwa_ first appeared in SCOP 1.73, called d2fjwa1
  
• d2fjwa_ was called d2fjwa1 in SCOP 1.75
  
• d2fjwa_ appears in SCOPe 2.02
  
• d2fjwa_ appears in the current release, SCOPe 2.08