Class e: Multi-domain proteins (alpha and beta) [56572] (53 folds) |
Fold e.8: DNA/RNA polymerases [56671] (1 superfamily) divided into morphological domains including "palm", "thumb" and "fingers"; the catalytic "palm" domain is conserved to all members |
Superfamily e.8.1: DNA/RNA polymerases [56672] (6 families) "palm" domain has a ferredoxin-like fold, related to that of an adenylyl cyclase domain |
Family e.8.1.2: Reverse transcriptase [56686] (2 proteins) |
Protein MMLV reverse transcriptase [56687] (1 species) |
Species Moloney murine leukemia virus, MoMLV [TaxId:11801] [56688] (18 PDB entries) |
Domain d2fjwa1: 2fjw A:24-278 [133624] automatically matched to d1d0ea_ mutant |
PDB Entry: 2fjw (more details), 1.95 Å
SCOP Domain Sequences for d2fjwa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2fjwa1 e.8.1.2 (A:24-278) MMLV reverse transcriptase {Moloney murine leukemia virus, MoMLV [TaxId: 11801]} twlsdfpqawaetggmglavrqapliiplkatstpvsikqypmsqearlgikphiqrlld qgilvpcqspwntpllpvkkpgtndyrpvqdlrevnkrvedihptvpnpynllsglppsh qwytvldlkdaffclrlhptsqplfafewrdpemgisgqltwtrlpqgfknsptlfdeal hrdladfriqhpdlillqyvddlllaatseldcqqgtrallqtlgnlgyrasakkaqicq kqvkylgyllkegqr
Timeline for d2fjwa1: