SCOP 1.73: Domain d2fjwa1: 2fjw A:24-278

Lineage for d2fjwa1 (2fjw A:24-278)

1. Root: SCOP 1.73

2. Class e: Multi-domain proteins (alpha and beta) [56572] (53 folds)

3. Fold e.8: DNA/RNA polymerases [56671] (1 superfamily)
   divided into morphological domains including "palm", "thumb" and "fingers"; the catalytic "palm" domain is conserved to all members

4. Superfamily e.8.1: DNA/RNA polymerases [56672] (6 families)
   "palm" domain has a ferredoxin-like fold, related to that of an adenylyl cyclase domain

5. Family e.8.1.2: Reverse transcriptase [56686] (2 proteins)

6. Protein MMLV reverse transcriptase [56687] (1 species)

7. Species Moloney murine leukemia virus, MoMLV [TaxId:11801] [56688] (18 PDB entries)

8. Domain d2fjwa1: 2fjw A:24-278 [133624]
   automatically matched to d1d0ea_
   mutant

Details for d2fjwa1

PDB Entry: 2fjw, 1.95 Å

PDB Description: d(cttgaatgcattcaag) in complex with mmlv rt catalytic fragment

PDB Compounds: (A:) reverse transcriptase

SCOP Domain Sequences for d2fjwa1:

Sequence; same for both SEQRES and ATOM records:

>d2fjwa1 e.8.1.2 (A:24-278) MMLV reverse transcriptase {Moloney murine leukemia virus, MoMLV [TaxId: 11801]}
twlsdfpqawaetggmglavrqapliiplkatstpvsikqypmsqearlgikphiqrlld
qgilvpcqspwntpllpvkkpgtndyrpvqdlrevnkrvedihptvpnpynllsglppsh
qwytvldlkdaffclrlhptsqplfafewrdpemgisgqltwtrlpqgfknsptlfdeal
hrdladfriqhpdlillqyvddlllaatseldcqqgtrallqtlgnlgyrasakkaqicq
kqvkylgyllkegqr

Timeline for d2fjwa1:

• d2fjwa1 is new in SCOP 1.73
  
• d2fjwa1 appears in SCOP 1.75
  
• d2fjwa1 appears in the current release, SCOPe 2.08, called d2fjwa_