| Class a: All alpha proteins [46456] (284 folds) |
| Fold a.22: Histone-fold [47112] (1 superfamily) core: 3 helices; long middle helix is flanked at each end with shorter ones |
Superfamily a.22.1: Histone-fold [47113] (4 families) ![]() |
| Family a.22.1.1: Nucleosome core histones [47114] (5 proteins) form octamers composed of two copies of each of the four histones |
| Protein Histone H2B [47119] (6 species) |
| Species African clawed frog (Xenopus laevis) [TaxId:8355] [47121] (26 PDB entries) |
| Domain d2fj7d1: 2fj7 D:30-122 [133550] Other proteins in same PDB: d2fj7a1, d2fj7b1, d2fj7e1, d2fj7f1 automatically matched to d1s32d_ |
PDB Entry: 2fj7 (more details), 3.2 Å
SCOP Domain Sequences for d2fj7d1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2fj7d1 a.22.1.1 (D:30-122) Histone H2B {African clawed frog (Xenopus laevis) [TaxId: 8355]}
rkesyaiyvykvlkqvhpdtgisskamsimnsfvndvferiageasrlahynkrstitsr
eiqtavrlllpgelakhavsegtkavtkytsak
Timeline for d2fj7d1: