Class d: Alpha and beta proteins (a+b) [53931] (380 folds) |
Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.4: Dimeric alpha+beta barrel [54909] (24 families) dimerizes through the beta-sheet; forms beta-sheet barrel, closed (n=8, S=12); dimers may assemble in higher oligomers |
Family d.58.4.16: Atu0297-like [143275] (2 proteins) Pfam PF07045; DUF1330 |
Protein Hypothetical protein Atu0297 [143276] (1 species) |
Species Agrobacterium tumefaciens [TaxId:358] [143277] (1 PDB entry) Uniprot Q8UIJ7 1-95 |
Domain d2fiua1: 2fiu A:1-95 [133537] Other proteins in same PDB: d2fiub_ |
PDB Entry: 2fiu (more details), 2 Å
SCOPe Domain Sequences for d2fiua1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2fiua1 d.58.4.16 (A:1-95) Hypothetical protein Atu0297 {Agrobacterium tumefaciens [TaxId: 358]} makgywiaqvdvrdserykdyvstakpaferfganflarggsvtelegtararnvviefp svqhaidcynspeyqaaakirqevadaemmivegi
Timeline for d2fiua1: