Lineage for d2fiua1 (2fiu A:1-95)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2949054Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2949708Superfamily d.58.4: Dimeric alpha+beta barrel [54909] (24 families) (S)
    dimerizes through the beta-sheet; forms beta-sheet barrel, closed (n=8, S=12); dimers may assemble in higher oligomers
  5. 2949996Family d.58.4.16: Atu0297-like [143275] (2 proteins)
    Pfam PF07045; DUF1330
  6. 2949997Protein Hypothetical protein Atu0297 [143276] (1 species)
  7. 2949998Species Agrobacterium tumefaciens [TaxId:358] [143277] (1 PDB entry)
    Uniprot Q8UIJ7 1-95
  8. 2949999Domain d2fiua1: 2fiu A:1-95 [133537]
    Other proteins in same PDB: d2fiua2, d2fiub2, d2fiub3

Details for d2fiua1

PDB Entry: 2fiu (more details), 2 Å

PDB Description: Crystal Structure of the Conserved Protein of Unknown Function ATU0297 from Agrobacterium tumefaciens
PDB Compounds: (A:) conserved hypothetical protein

SCOPe Domain Sequences for d2fiua1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2fiua1 d.58.4.16 (A:1-95) Hypothetical protein Atu0297 {Agrobacterium tumefaciens [TaxId: 358]}
makgywiaqvdvrdserykdyvstakpaferfganflarggsvtelegtararnvviefp
svqhaidcynspeyqaaakirqevadaemmivegi

SCOPe Domain Coordinates for d2fiua1:

Click to download the PDB-style file with coordinates for d2fiua1.
(The format of our PDB-style files is described here.)

Timeline for d2fiua1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2fiua2