Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest |
Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (61 families) |
Family c.66.1.46: YhhF-like [142611] (6 proteins) Pfam PF03602 |
Protein Putative methylase EF2452 [142612] (1 species) |
Species Enterococcus faecalis [TaxId:1351] [142613] (1 PDB entry) Uniprot Q831P8 1-182 |
Domain d2fhpa1: 2fhp A:1-182 [133495] Other proteins in same PDB: d2fhpa2, d2fhpb2, d2fhpb3 |
PDB Entry: 2fhp (more details), 1.6 Å
SCOPe Domain Sequences for d2fhpa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2fhpa1 c.66.1.46 (A:1-182) Putative methylase EF2452 {Enterococcus faecalis [TaxId: 1351]} mrvisgeyggrrlkaldgdntrpttdkvkesifnmigpyfdggmaldlysgsgglaieav srgmdksicieknfaalkvikeniaitkepekfevrkmdanraleqfyeeklqfdlvlld ppyakqeivsqlekmlerqlltneavivcetdktvklpetigtlkktretvygitqvtiy rq
Timeline for d2fhpa1: