PDB entry 2fhp

View 2fhp on RCSB PDB site
Description: Crystal Structure of Putative Methylase from Enterococcus faecalis
Class: structural genomics, unknown function
Keywords: alpha-beta-alpha sandwich, Structural Genomics, PSI, Protein Structure Initiative, Midwest Center for Structural Genomics, MCSG, UNKNOWN FUNCTION
Deposited on 2005-12-26, released 2006-02-07
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.183
AEROSPACI score: 0.59 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: methylase, putative
    Species: Enterococcus faecalis [TaxId:226185]
    Database cross-references and differences (RAF-indexed):
    • GB AAO82170 (2-End)
      • cloning artifact (2)
      • modified residue (3)
      • modified residue (37)
      • modified residue (46)
      • modified residue (66)
      • modified residue (100)
      • modified residue (137)
    Domains in SCOPe 2.08: d2fhpa1, d2fhpa2
  • Chain 'B':
    Compound: methylase, putative
    Species: Enterococcus faecalis [TaxId:226185]
    Database cross-references and differences (RAF-indexed):
    • GB AAO82170 (2-185)
      • cloning artifact (2)
      • modified residue (3)
      • modified residue (37)
      • modified residue (46)
      • modified residue (66)
      • modified residue (100)
      • modified residue (137)
    Domains in SCOPe 2.08: d2fhpb2, d2fhpb3
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2fhpA (A:)
    snamrvisgeyggrrlkaldgdntrpttdkvkesifnmigpyfdggmaldlysgsgglai
    eavsrgmdksicieknfaalkvikeniaitkepekfevrkmdanraleqfyeeklqfdlv
    lldppyakqeivsqlekmlerqlltneavivcetdktvklpetigtlkktretvygitqv
    tiyrqea
    

    Sequence, based on observed residues (ATOM records): (download)
    >2fhpA (A:)
    amrvisgeyggrrlkaldgdntrpttdkvkesifnmigpyfdggmaldlysgsgglaiea
    vsrgmdksicieknfaalkvikeniaitkepekfevrkmdanraleqfyeeklqfdlvll
    dppyakqeivsqlekmlerqlltneavivcetdktvklpetigtlkktretvygitqvti
    yrq
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2fhpB (B:)
    snamrvisgeyggrrlkaldgdntrpttdkvkesifnmigpyfdggmaldlysgsgglai
    eavsrgmdksicieknfaalkvikeniaitkepekfevrkmdanraleqfyeeklqfdlv
    lldppyakqeivsqlekmlerqlltneavivcetdktvklpetigtlkktretvygitqv
    tiyrqea
    

    Sequence, based on observed residues (ATOM records): (download)
    >2fhpB (B:)
    amrvisgeyggrrlkaldgtdkvkesifnmigpyfdggmaldlysgsgglaieavsrgmd
    ksicieknfaalkvikeniaitkepekfevrkmdanraleqfyeeklqfdlvlldppyak
    qeivsqlekmlerqlltneavivcetdktvklpetigtlkktretvygitqvtiyrqe