Class d: Alpha and beta proteins (a+b) [53931] (334 folds) |
Fold d.109: Gelsolin-like [55752] (2 superfamilies) 3 layers: a/b/a; contains mixed beta-sheet |
Superfamily d.109.1: Actin depolymerizing proteins [55753] (2 families) |
Family d.109.1.1: Gelsolin-like [55754] (4 proteins) |
Protein Gelsolin [55759] (2 species) consists of six similar domains |
Species Human (Homo sapiens) [TaxId:9606] [55761] (24 PDB entries) |
Domain d2fh3a2: 2fh3 A:533-628 [133460] automatically matched to d1h1vg2 complexed with ca |
PDB Entry: 2fh3 (more details), 2.87 Å
SCOP Domain Sequences for d2fh3a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2fh3a2 d.109.1.1 (A:533-628) Gelsolin {Human (Homo sapiens) [TaxId: 9606]} pastrlfqvransagatravevlpkagalnsndafvlktpsaaylwvgtgaseaektgaq ellrvlraqpvqvaegsepdgfwealggkaayrtsp
Timeline for d2fh3a2: