PDB entry 2fh3

View 2fh3 on RCSB PDB site
Description: C-terminal half of gelsolin soaked in low calcium at pH 8
Class: contractile protein
Keywords: gelsolin, calcium
Deposited on 2005-12-23, released 2006-06-13
The last revision prior to the SCOP 1.73 freeze date was dated 2006-06-13, with a file datestamp of 2007-06-28.
Experiment type: XRAY
Resolution: 2.87 Å
R-factor: 0.203
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: gelsolin
    Species: HOMO SAPIENS
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d2fh3a1, d2fh3a2, d2fh3a3
  • Chain 'B':
    Compound: gelsolin
    Species: HOMO SAPIENS
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d2fh3b1, d2fh3b2, d2fh3b3
  • Chain 'C':
    Compound: gelsolin
    Species: HOMO SAPIENS
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d2fh3c1, d2fh3c2, d2fh3c3
  • Heterogens: CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2fh3A (A:)
    mdddgtgqkqiwriegsnkvpvdpatygqfyggdsyiilynyrhggrqgqiiynwqgaqs
    tqdevaasailtaqldeelggtpvqsrvvqgkepahlmslfggkpmiiykggtsreggqt
    apastrlfqvransagatravevlpkagalnsndafvlktpsaaylwvgtgaseaektga
    qellrvlraqpvqvaegsepdgfwealggkaayrtsprlkdkkmdahpprlfacsnkigr
    fvieevpgelmqedlatddvmlldtwdqvfvwvgkdsqeeektealtsakryietdpanr
    drrtpitvvkqgfeppsfvgwflgwdddywsvdpldramaelaa
    

    Sequence, based on observed residues (ATOM records): (download)
    >2fh3A (A:)
    mdddgtgqkqiwriegsnkvpvdpatygqfyggdsyiilynyrhggrqgqiiynwqgaqs
    tqdevaasailtaqldeelggtpvqsrvvqgkepahlmslfggkpmiiykggtsreggqt
    apastrlfqvransagatravevlpkagalnsndafvlktpsaaylwvgtgaseaektga
    qellrvlraqpvqvaegsepdgfwealggkaayrtsprlkdkkmhpprlfacsnkigrfv
    ieevpgelmqedlatddvmlldtwdqvfvwvgkdsqeeektealtsakryietdtpitvv
    kqgfeppsfvgwflgwdddyw
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2fh3B (B:)
    mdddgtgqkqiwriegsnkvpvdpatygqfyggdsyiilynyrhggrqgqiiynwqgaqs
    tqdevaasailtaqldeelggtpvqsrvvqgkepahlmslfggkpmiiykggtsreggqt
    apastrlfqvransagatravevlpkagalnsndafvlktpsaaylwvgtgaseaektga
    qellrvlraqpvqvaegsepdgfwealggkaayrtsprlkdkkmdahpprlfacsnkigr
    fvieevpgelmqedlatddvmlldtwdqvfvwvgkdsqeeektealtsakryietdpanr
    drrtpitvvkqgfeppsfvgwflgwdddywsvdpldramaelaa
    

    Sequence, based on observed residues (ATOM records): (download)
    >2fh3B (B:)
    ddgtgqkqiwriegsnkvpvdpatygqfyggdsyiilynyrqgqiiynwqgaqstqdeva
    asailtaqldeelggtpvqsrvvqgkepahlmslfggkpmiiykggtsreggqtapastr
    lfqvransagatravevlpkagalnsndafvlktpsaaylwvgtgaseaektgaqellrv
    lraqpvqvaegsepdgfwealggkaayrtsprlkdkkmdahpprlfacsnkigrfvieev
    pgelmqedlatddvmlldtwdqvfvwvgkdsqeeektealtsakryietdpanrdrrtpi
    tvvkqgfeppsfvgwflgwdddyw
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2fh3C (C:)
    mdddgtgqkqiwriegsnkvpvdpatygqfyggdsyiilynyrhggrqgqiiynwqgaqs
    tqdevaasailtaqldeelggtpvqsrvvqgkepahlmslfggkpmiiykggtsreggqt
    apastrlfqvransagatravevlpkagalnsndafvlktpsaaylwvgtgaseaektga
    qellrvlraqpvqvaegsepdgfwealggkaayrtsprlkdkkmdahpprlfacsnkigr
    fvieevpgelmqedlatddvmlldtwdqvfvwvgkdsqeeektealtsakryietdpanr
    drrtpitvvkqgfeppsfvgwflgwdddywsvdpldramaelaa
    

    Sequence, based on observed residues (ATOM records): (download)
    >2fh3C (C:)
    ddgtgqkqiwriegsnkvpvdpatygqfyggdsyiilynygqiiynwqgaqstqdevaas
    ailtaqldeelggtpvqsrvvqgkepahlmslfggkpmiiykggtsreggqtapastrlf
    qvransagatravevlpkagalnsndafvlktpsaaylwvgtgaseaektgaqellrvlr
    aqpvqvaegsepdgfwealggkaayrtsprlkdkkmdahpprlfacsnkigrfvieevpg
    elmqedlatddvmlldtwdqvfvwvgkdsqeeektealtsakryietdpanrdrrtpitv
    vkqgfeppsfvgwflgwdddyw