Lineage for d1h1vg2 (1h1v G:533-628)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 731406Fold d.109: Gelsolin-like [55752] (2 superfamilies)
    3 layers: a/b/a; contains mixed beta-sheet
  4. 731407Superfamily d.109.1: Actin depolymerizing proteins [55753] (2 families) (S)
  5. 731408Family d.109.1.1: Gelsolin-like [55754] (4 proteins)
  6. 731409Protein Gelsolin [55759] (2 species)
    consists of six similar domains
  7. 731426Species Human (Homo sapiens) [TaxId:9606] [55761] (24 PDB entries)
  8. 731480Domain d1h1vg2: 1h1v G:533-628 [76504]
    Other proteins in same PDB: d1h1va1, d1h1va2

Details for d1h1vg2

PDB Entry: 1h1v (more details), 3 Å

PDB Description: gelsolin g4-g6/actin complex
PDB Compounds: (G:) gelsolin

SCOP Domain Sequences for d1h1vg2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1h1vg2 d.109.1.1 (G:533-628) Gelsolin {Human (Homo sapiens) [TaxId: 9606]}
pastrlfqvransagatravevlpkagalnsndafvlktpsaaylwvgtgaseaektgaq
ellrvlraqpvqvaegsepdgfwealggkaayrtsp

SCOP Domain Coordinates for d1h1vg2:

Click to download the PDB-style file with coordinates for d1h1vg2.
(The format of our PDB-style files is described here.)

Timeline for d1h1vg2: