SCOPe 2.05: Domain d2fgca2: 2fgc A:27-104

Lineage for d2fgca2 (2fgc A:27-104)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.18: ACT-like [55021] (15 families)
   regulatory domain linked to a wide range of metabolic enzymes

5. Family d.58.18.6: IlvH-like [143376] (1 protein)
   Duplication: tandem repeat of two ACT-like domains; dimer, the N- and C-terminal domains have different dimerisation modes

6. Protein Acetolactate synthase small subunit, IlvH [143377] (3 species)

7. Species Thermotoga maritima [TaxId:2336] [143378] (1 PDB entry)
   Uniprot Q9WZ19 5-82! Uniprot Q9WZ19 83-165

8. Domain d2fgca2: 2fgc A:27-104 [133429]
   complexed with mg

Details for d2fgca2

PDB Entry: 2fgc, 2.3 Å

PDB Description: crystal structure of acetolactate synthase- small subunit from thermotoga maritima

PDB Compounds: (A:) acetolactate synthase, small subunit

SCOPe Domain Sequences for d2fgca2:

Sequence; same for both SEQRES and ATOM records:

>d2fgca2 d.58.18.6 (A:27-104) Acetolactate synthase small subunit, IlvH {Thermotoga maritima [TaxId: 2336]}
irehlvsmlvhnkpgvmrkvanlfarrgfnissitvgesetpglsrlvimvkgddktieq
iekqayklvevvkvtpid

Timeline for d2fgca2:

• d2fgca2 first appeared in SCOP 1.73
  
• d2fgca2 appears in SCOPe 2.04
  
• d2fgca2 appears in SCOPe 2.06
  
• d2fgca2 appears in the current release, SCOPe 2.08