Lineage for d2fgca2 (2fgc A:27-104)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2949054Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2954059Superfamily d.58.18: ACT-like [55021] (15 families) (S)
    regulatory domain linked to a wide range of metabolic enzymes
  5. 2954157Family d.58.18.6: IlvH-like [143376] (2 proteins)
    Duplication: tandem repeat of two ACT-like domains; dimer, the N- and C-terminal domains have different dimerisation modes
  6. 2954158Protein Acetolactate synthase small subunit, IlvH [143377] (3 species)
  7. 2954173Species Thermotoga maritima [TaxId:2336] [143378] (1 PDB entry)
    Uniprot Q9WZ19 5-82! Uniprot Q9WZ19 83-165
  8. 2954175Domain d2fgca2: 2fgc A:27-104 [133429]
    complexed with mg

Details for d2fgca2

PDB Entry: 2fgc (more details), 2.3 Å

PDB Description: crystal structure of acetolactate synthase- small subunit from thermotoga maritima
PDB Compounds: (A:) acetolactate synthase, small subunit

SCOPe Domain Sequences for d2fgca2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2fgca2 d.58.18.6 (A:27-104) Acetolactate synthase small subunit, IlvH {Thermotoga maritima [TaxId: 2336]}
irehlvsmlvhnkpgvmrkvanlfarrgfnissitvgesetpglsrlvimvkgddktieq
iekqayklvevvkvtpid

SCOPe Domain Coordinates for d2fgca2:

Click to download the PDB-style file with coordinates for d2fgca2.
(The format of our PDB-style files is described here.)

Timeline for d2fgca2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2fgca1