![]() | Class d: Alpha and beta proteins (a+b) [53931] (334 folds) |
![]() | Fold d.58: Ferredoxin-like [54861] (55 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
![]() | Superfamily d.58.18: ACT-like [55021] (12 families) ![]() regulatory domain linked to a wide range of metabolic enzymes |
![]() | Family d.58.18.6: IlvH-like [143376] (1 protein) Duplication: tandem repeat of two ACT-like domains; dimer, the N- and C-terminal domains have different dimerisation modes |
![]() | Protein Acetolactate synthase small subunit, IlvH [143377] (3 species) |
![]() | Species Thermotoga maritima [TaxId:2336] [143378] (1 PDB entry) |
![]() | Domain d2fgca2: 2fgc A:27-104 [133429] complexed with mg |
PDB Entry: 2fgc (more details), 2.3 Å
SCOP Domain Sequences for d2fgca2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2fgca2 d.58.18.6 (A:27-104) Acetolactate synthase small subunit, IlvH {Thermotoga maritima [TaxId: 2336]} irehlvsmlvhnkpgvmrkvanlfarrgfnissitvgesetpglsrlvimvkgddktieq iekqayklvevvkvtpid
Timeline for d2fgca2: