![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.3: Cysteine proteinases [54000] (1 superfamily) consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn |
![]() | Superfamily d.3.1: Cysteine proteinases [54001] (24 families) ![]() the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet |
![]() | Family d.3.1.16: NlpC/P60 [142873] (2 proteins) Pfam PF00877 |
![]() | Protein Cell wall-associated hydrolase Spr C-terminal domain [142874] (1 species) |
![]() | Species Nostoc punctiforme [TaxId:272131] [142875] (2 PDB entries) Uniprot Q8YRR4 87-234 |
![]() | Domain d2fg0a2: 2fg0 A:87-234 [133397] Other proteins in same PDB: d2fg0a1, d2fg0b1 automated match to d2evra2 complexed with gol |
PDB Entry: 2fg0 (more details), 1.79 Å
SCOPe Domain Sequences for d2fg0a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2fg0a2 d.3.1.16 (A:87-234) Cell wall-associated hydrolase Spr C-terminal domain {Nostoc punctiforme [TaxId: 272131]} tfseseikkllaeviaftqkamqqsnyylwggtvgpnydcsglmqaafasvgiwlprday qqegftqpitiaelvagdlvffgtsqkathvglyladgyyihssgkdqgrdgigidilse qgdavslsyyqqlrgagrvfksyepqrr
Timeline for d2fg0a2: