Lineage for d2fg0b2 (2fg0 B:87-234)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2926589Fold d.3: Cysteine proteinases [54000] (1 superfamily)
    consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn
  4. 2926590Superfamily d.3.1: Cysteine proteinases [54001] (24 families) (S)
    the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet
  5. 2927487Family d.3.1.16: NlpC/P60 [142873] (2 proteins)
    Pfam PF00877
  6. 2927488Protein Cell wall-associated hydrolase Spr C-terminal domain [142874] (1 species)
  7. 2927489Species Nostoc punctiforme [TaxId:272131] [142875] (2 PDB entries)
    Uniprot Q8YRR4 87-234
  8. 2927492Domain d2fg0b2: 2fg0 B:87-234 [133399]
    Other proteins in same PDB: d2fg0a1, d2fg0b1
    automated match to d2evra2
    complexed with gol

Details for d2fg0b2

PDB Entry: 2fg0 (more details), 1.79 Å

PDB Description: crystal structure of a putative gamma-d-glutamyl-l-diamino acid endopeptidase (npun_r0659) from nostoc punctiforme pcc 73102 at 1.79 a resolution
PDB Compounds: (B:) COG0791: Cell wall-associated hydrolases (invasion-associated proteins)

SCOPe Domain Sequences for d2fg0b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2fg0b2 d.3.1.16 (B:87-234) Cell wall-associated hydrolase Spr C-terminal domain {Nostoc punctiforme [TaxId: 272131]}
tfseseikkllaeviaftqkamqqsnyylwggtvgpnydcsglmqaafasvgiwlprday
qqegftqpitiaelvagdlvffgtsqkathvglyladgyyihssgkdqgrdgigidilse
qgdavslsyyqqlrgagrvfksyepqrr

SCOPe Domain Coordinates for d2fg0b2:

Click to download the PDB-style file with coordinates for d2fg0b2.
(The format of our PDB-style files is described here.)

Timeline for d2fg0b2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2fg0b1