Lineage for d2fg0a2 (2fg0 A:87-234)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 715176Fold d.3: Cysteine proteinases [54000] (1 superfamily)
    consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn
  4. 715177Superfamily d.3.1: Cysteine proteinases [54001] (16 families) (S)
    the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet
  5. 715655Family d.3.1.16: NlpC/P60 [142873] (1 protein)
    Pfam PF00877
  6. 715656Protein Cell wall-associated hydrolase Spr C-terminal domain [142874] (1 species)
  7. 715657Species Nostoc punctiforme [TaxId:272131] [142875] (2 PDB entries)
  8. 715659Domain d2fg0a2: 2fg0 A:87-234 [133397]
    Other proteins in same PDB: d2fg0a1, d2fg0b1
    automatically matched to 2EVR A:87-234
    complexed with gol

Details for d2fg0a2

PDB Entry: 2fg0 (more details), 1.79 Å

PDB Description: crystal structure of a putative gamma-d-glutamyl-l-diamino acid endopeptidase (npun_r0659) from nostoc punctiforme pcc 73102 at 1.79 a resolution
PDB Compounds: (A:) COG0791: Cell wall-associated hydrolases (invasion-associated proteins)

SCOP Domain Sequences for d2fg0a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2fg0a2 d.3.1.16 (A:87-234) Cell wall-associated hydrolase Spr C-terminal domain {Nostoc punctiforme [TaxId: 272131]}
tfseseikkllaeviaftqkamqqsnyylwggtvgpnydcsglmqaafasvgiwlprday
qqegftqpitiaelvagdlvffgtsqkathvglyladgyyihssgkdqgrdgigidilse
qgdavslsyyqqlrgagrvfksyepqrr

SCOP Domain Coordinates for d2fg0a2:

Click to download the PDB-style file with coordinates for d2fg0a2.
(The format of our PDB-style files is described here.)

Timeline for d2fg0a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2fg0a1