Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.70: Nucleoside hydrolase [53589] (1 superfamily) core: 3 layers, a/b/a ; mixed beta-sheet of 8 strands, order 32145687; strand 7 is antiparallel to the rest |
Superfamily c.70.1: Nucleoside hydrolase [53590] (2 families) |
Family c.70.1.1: Nucleoside hydrolase [53591] (5 proteins) automatically mapped to Pfam PF01156 |
Protein automated matches [190287] (2 species) not a true protein |
Species Trypanosoma vivax [TaxId:5699] [187091] (5 PDB entries) |
Domain d2ff2b_: 2ff2 B: [133363] automated match to d1hoza_ complexed with ca, imh, ni |
PDB Entry: 2ff2 (more details), 2.2 Å
SCOPe Domain Sequences for d2ff2b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ff2b_ c.70.1.1 (B:) automated matches {Trypanosoma vivax [TaxId: 5699]} saknvvldhdgnlddfvamvllasntekvrligalctdadcfvengfnvtgkimclmhnn mnlplfpigksaatavnpfpkewrclaknmddmpilnipenvelwdkikaenekyegqql ladlvmnseekvticvtgplsnvawcidkygekftskveecvimggavdvrgnvflpstd gtaewniywdpasaktvfgcpglrrimfsldstntvpvrspyvqrfgeqtnfllsilvgt mwamcthcellrdgdgyyawdaltaayvvdqkvanvdpvpidvvvdkqpnegatvrtdae nypltfvarnpeaeffldmllrsarac
Timeline for d2ff2b_: