Lineage for d2ff2b1 (2ff2 B:0-327)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 707691Fold c.70: Nucleoside hydrolase [53589] (1 superfamily)
    core: 3 layers, a/b/a ; mixed beta-sheet of 8 strands, order 32145687; strand 7 is antiparallel to the rest
  4. 707692Superfamily c.70.1: Nucleoside hydrolase [53590] (1 family) (S)
  5. 707693Family c.70.1.1: Nucleoside hydrolase [53591] (4 proteins)
  6. 707694Protein Inosine-adenosine-guanosine preferring nucleoside hydrolase [69587] (1 species)
  7. 707695Species Trypanosoma vivax [TaxId:5699] [69588] (7 PDB entries)
  8. 707705Domain d2ff2b1: 2ff2 B:0-327 [133363]
    automatically matched to d1hoza_
    complexed with ca, imh, ni

Details for d2ff2b1

PDB Entry: 2ff2 (more details), 2.2 Å

PDB Description: Crystal structure of Trypanosoma vivax nucleoside hydrolase co-crystallized with ImmucillinH
PDB Compounds: (B:) IAG-nucleoside hydrolase

SCOP Domain Sequences for d2ff2b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ff2b1 c.70.1.1 (B:0-327) Inosine-adenosine-guanosine preferring nucleoside hydrolase {Trypanosoma vivax [TaxId: 5699]}
saknvvldhdgnlddfvamvllasntekvrligalctdadcfvengfnvtgkimclmhnn
mnlplfpigksaatavnpfpkewrclaknmddmpilnipenvelwdkikaenekyegqql
ladlvmnseekvticvtgplsnvawcidkygekftskveecvimggavdvrgnvflpstd
gtaewniywdpasaktvfgcpglrrimfsldstntvpvrspyvqrfgeqtnfllsilvgt
mwamcthcellrdgdgyyawdaltaayvvdqkvanvdpvpidvvvdkqpnegatvrtdae
nypltfvarnpeaeffldmllrsarac

SCOP Domain Coordinates for d2ff2b1:

Click to download the PDB-style file with coordinates for d2ff2b1.
(The format of our PDB-style files is described here.)

Timeline for d2ff2b1: