Lineage for d2feja1 (2fej A:96-290)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1300526Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (10 superfamilies)
    sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold
  4. 1300967Superfamily b.2.5: p53-like transcription factors [49417] (7 families) (S)
  5. 1300968Family b.2.5.2: p53 DNA-binding domain-like [81314] (3 proteins)
  6. 1300969Protein p53 tumor suppressor, DNA-binding domain [49419] (2 species)
  7. 1300970Species Human (Homo sapiens) [TaxId:9606] [49420] (32 PDB entries)
  8. 1301050Domain d2feja1: 2fej A:96-290 [133349]
    automatically matched to d1uola_
    complexed with zn

Details for d2feja1

PDB Entry: 2fej (more details)

PDB Description: solution structure of human p53 dna binding domain.
PDB Compounds: (A:) Cellular tumor antigen p53

SCOPe Domain Sequences for d2feja1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2feja1 b.2.5.2 (A:96-290) p53 tumor suppressor, DNA-binding domain {Human (Homo sapiens) [TaxId: 9606]}
svpsqktyqgsygfrlgflhsgtaksvtctyspalnkmfcqlaktcpvqlwvdstpppgt
rvramaiykqsqhmtevvrrcphhercsdsdglappqhlirvegnlrveylddrntfrhs
vvvpyeppevgsdcttihynymcnsscmggmnrrpiltiitledssgnllgrnsfevrvc
acpgrdrrteeenlr

SCOPe Domain Coordinates for d2feja1:

Click to download the PDB-style file with coordinates for d2feja1.
(The format of our PDB-style files is described here.)

Timeline for d2feja1: