SCOP 1.73: Domain d2feja1: 2fej A:96-290

Lineage for d2feja1 (2fej A:96-290)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (10 superfamilies)
   sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold

4. Superfamily b.2.5: p53-like transcription factors [49417] (7 families)

5. Family b.2.5.2: p53 DNA-binding domain-like [81314] (2 proteins)

6. Protein p53 tumor suppressor, DNA-binding domain [49419] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [49420] (13 PDB entries)

8. Domain d2feja1: 2fej A:96-290 [133349]
   automatically matched to d1uola_
   complexed with zn

Details for d2feja1

PDB Entry: 2fej

PDB Description: solution structure of human p53 dna binding domain.

PDB Compounds: (A:) Cellular tumor antigen p53

SCOP Domain Sequences for d2feja1:

Sequence; same for both SEQRES and ATOM records:

>d2feja1 b.2.5.2 (A:96-290) p53 tumor suppressor, DNA-binding domain {Human (Homo sapiens) [TaxId: 9606]}
svpsqktyqgsygfrlgflhsgtaksvtctyspalnkmfcqlaktcpvqlwvdstpppgt
rvramaiykqsqhmtevvrrcphhercsdsdglappqhlirvegnlrveylddrntfrhs
vvvpyeppevgsdcttihynymcnsscmggmnrrpiltiitledssgnllgrnsfevrvc
acpgrdrrteeenlr

Timeline for d2feja1:

• d2feja1 is new in SCOP 1.73
  
• d2feja1 appears in SCOP 1.75
  
• d2feja1 appears in the current release, SCOPe 2.08, called d2feja_