SCOPe 2.07: Domain d2feco1: 2fec O:1-105

Lineage for d2feco1 (2fec O:1-105)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (16 species)
   VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogenous CDRs are listed as engineered species

7. Species Mouse (Mus musculus), cluster 3.2 [TaxId:10090] [88528] (42 PDB entries)
   Uniprot P04940 # KV6F_MOUSE IG KAPPA CHAIN V-VI REGION NQ2-17.4.1

8. Domain d2feco1: 2fec O:1-105 [133331]
   Other proteins in same PDB: d2feca1, d2fecb1, d2fecl2, d2feco2
   automatically matched to d1dqdl1
   mutant

Details for d2feco1

PDB Entry: 2fec, 3.97 Å

PDB Description: structure of the e203q mutant of the cl-/h+ exchanger clc-ec1 from e.coli

PDB Compounds: (O:) Fab fragment, light chain

SCOPe Domain Sequences for d2feco1:

Sequence; same for both SEQRES and ATOM records:

>d2feco1 b.1.1.1 (O:1-105) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 3.2 [TaxId: 10090]}
divltqspaimsaapgdkvtmtcsasssvsyihwyqqksgtspkrwiydtskltsgvpvr
fsgsgsgtsysltintmeaedaatyycqqwsshpqtfgggtklei

Timeline for d2feco1:

• d2feco1 first appeared in SCOP 1.73
  
• d2feco1 appears in SCOPe 2.06
  
• d2feco1 appears in the current release, SCOPe 2.08