Lineage for d2fdra1 (2fdr A:3-224)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2919479Fold c.108: HAD-like [56783] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456
  4. 2919480Superfamily c.108.1: HAD-like [56784] (26 families) (S)
    usually contains an insertion (sub)domain after strand 1
  5. 2919696Family c.108.1.6: beta-Phosphoglucomutase-like [75173] (10 proteins)
    the insertion subdomain is a 4-helical bundle
  6. 2919768Protein Hypothetical protein Atu0790 [142141] (1 species)
  7. 2919769Species Agrobacterium tumefaciens [TaxId:358] [142142] (1 PDB entry)
    Uniprot Q8UH93 3-224
  8. 2919770Domain d2fdra1: 2fdr A:3-224 [133319]
    complexed with mg

Details for d2fdra1

PDB Entry: 2fdr (more details), 2 Å

PDB Description: crystal structure of conserved haloacid dehalogenase-like protein of unknown function atu0790 from agrobacterium tumefaciens str. c58
PDB Compounds: (A:) conserved hypothetical protein

SCOPe Domain Sequences for d2fdra1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2fdra1 c.108.1.6 (A:3-224) Hypothetical protein Atu0790 {Agrobacterium tumefaciens [TaxId: 358]}
gfdliifdcdgvlvdseiiaaqvesrllteagypisveemgerfagmtwknillqvesea
siplsaslldkseklldmrlerdvkiidgvkfalsrlttprcicsnssshrldmmltkvg
lkpyfaphiysakdlgadrvkpkpdiflhgaaqfgvspdrvvvvedsvhgihgaraagmr
vigftgashtypshadrltdagaetvisrmqdlpaviaamae

SCOPe Domain Coordinates for d2fdra1:

Click to download the PDB-style file with coordinates for d2fdra1.
(The format of our PDB-style files is described here.)

Timeline for d2fdra1: