SCOPe 2.07: Domain d2fdra1: 2fdr A:3-224

Lineage for d2fdra1 (2fdr A:3-224)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.108: HAD-like [56783] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456

4. Superfamily c.108.1: HAD-like [56784] (26 families)
   usually contains an insertion (sub)domain after strand 1

5. Family c.108.1.6: beta-Phosphoglucomutase-like [75173] (10 proteins)
   the insertion subdomain is a 4-helical bundle

6. Protein Hypothetical protein Atu0790 [142141] (1 species)

7. Species Agrobacterium tumefaciens [TaxId:358] [142142] (1 PDB entry)
   Uniprot Q8UH93 3-224

8. Domain d2fdra1: 2fdr A:3-224 [133319]
   complexed with mg

Details for d2fdra1

PDB Entry: 2fdr, 2 Å

PDB Description: crystal structure of conserved haloacid dehalogenase-like protein of unknown function atu0790 from agrobacterium tumefaciens str. c58

PDB Compounds: (A:) conserved hypothetical protein

SCOPe Domain Sequences for d2fdra1:

Sequence; same for both SEQRES and ATOM records:

>d2fdra1 c.108.1.6 (A:3-224) Hypothetical protein Atu0790 {Agrobacterium tumefaciens [TaxId: 358]}
gfdliifdcdgvlvdseiiaaqvesrllteagypisveemgerfagmtwknillqvesea
siplsaslldkseklldmrlerdvkiidgvkfalsrlttprcicsnssshrldmmltkvg
lkpyfaphiysakdlgadrvkpkpdiflhgaaqfgvspdrvvvvedsvhgihgaraagmr
vigftgashtypshadrltdagaetvisrmqdlpaviaamae

Timeline for d2fdra1:

• d2fdra1 first appeared in SCOP 1.73
  
• d2fdra1 appears in SCOPe 2.06
  
• d2fdra1 appears in the current release, SCOPe 2.08