PDB entry 2fdr

View 2fdr on RCSB PDB site
Description: Crystal Structure of Conserved Haloacid Dehalogenase-like Protein of Unknown Function ATU0790 from Agrobacterium tumefaciens str. C58
Class: structural genomics, unknown function
Keywords: conserved hypothetical, SAD, Structural genomics, Agrobacterium tumefaciens, HAD-superfamily hydrolase, putative b-phosphoglucomutase, PSI, Protein Structure Initiative, Midwest Center for Structural Genomics, MCSG, UNKNOWN FUNCTION
Deposited on 2005-12-14, released 2006-01-31
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-10-18, with a file datestamp of 2017-10-13.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: conserved hypothetical protein
    Species: Agrobacterium tumefaciens [TaxId:176299]
    Database cross-references and differences (RAF-indexed):
    • GB AAL41806
      • modified residue (41)
      • modified residue (48)
      • modified residue (79)
      • modified residue (115-116)
      • modified residue (180)
      • modified residue (211)
      • modified residue (221)
    Domains in SCOPe 2.08: d2fdra1
  • Heterogens: MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2fdrA (A:)
    msgfdliifdcdgvlvdseiiaaqvesrllteagypisveemgerfagmtwknillqves
    easiplsaslldkseklldmrlerdvkiidgvkfalsrlttprcicsnssshrldmmltk
    vglkpyfaphiysakdlgadrvkpkpdiflhgaaqfgvspdrvvvvedsvhgihgaraag
    mrvigftgashtypshadrltdagaetvisrmqdlpaviaamaewegaf
    

    Sequence, based on observed residues (ATOM records): (download)
    >2fdrA (A:)
    gfdliifdcdgvlvdseiiaaqvesrllteagypisveemgerfagmtwknillqvesea
    siplsaslldkseklldmrlerdvkiidgvkfalsrlttprcicsnssshrldmmltkvg
    lkpyfaphiysakdlgadrvkpkpdiflhgaaqfgvspdrvvvvedsvhgihgaraagmr
    vigftgashtypshadrltdagaetvisrmqdlpaviaamae