Lineage for d2fb7a1 (2fb7 A:16-95)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2057136Fold b.38: Sm-like fold [50181] (5 superfamilies)
    core: barrel, open; n*=4, S*=8; meander; SH3-like topology
  4. 2057137Superfamily b.38.1: Sm-like ribonucleoproteins [50182] (7 families) (S)
  5. 2057673Family b.38.1.5: LSM14 N-terminal domain-like [141297] (2 proteins)
    automatically mapped to Pfam PF14438
    automatically mapped to Pfam PF12701
  6. Protein LSM14 homolog A (Lsm14a) [141298] (1 species)
  7. Species Zebrafish (Danio rerio) [TaxId:7955] [141299] (1 PDB entry)
    Uniprot Q6P111 6-85
  8. 2057676Domain d2fb7a1: 2fb7 A:16-95 [133238]

Details for d2fb7a1

PDB Entry: 2fb7 (more details)

PDB Description: nmr solution structure of protein from zebra fish dr.13312
PDB Compounds: (A:) Sm-like protein, LSm-14_N (RAP55)

SCOPe Domain Sequences for d2fb7a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2fb7a1 b.38.1.5 (A:16-95) LSM14 homolog A (Lsm14a) {Zebrafish (Danio rerio) [TaxId: 7955]}
pyigskisliskaeiryegilytidtenstvalakvrsfgtedrptdrpiaprdetfeyi
ifrgsdikdltvceppkpim

SCOPe Domain Coordinates for d2fb7a1:

Click to download the PDB-style file with coordinates for d2fb7a1.
(The format of our PDB-style files is described here.)

Timeline for d2fb7a1: