Class b: All beta proteins [48724] (177 folds) |
Fold b.38: Sm-like fold [50181] (5 superfamilies) core: barrel, open; n*=4, S*=8; meander; SH3-like topology |
Superfamily b.38.1: Sm-like ribonucleoproteins [50182] (7 families) |
Family b.38.1.5: LSM14 N-terminal domain-like [141297] (2 proteins) automatically mapped to Pfam PF14438 automatically mapped to Pfam PF12701 |
Domain d2fb7a1: 2fb7 A:16-95 [133238] |
PDB Entry: 2fb7 (more details)
SCOPe Domain Sequences for d2fb7a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2fb7a1 b.38.1.5 (A:16-95) LSM14 homolog A (Lsm14a) {Zebrafish (Danio rerio) [TaxId: 7955]} pyigskisliskaeiryegilytidtenstvalakvrsfgtedrptdrpiaprdetfeyi ifrgsdikdltvceppkpim
Timeline for d2fb7a1: