Lineage for d2fb7a1 (2fb7 A:16-95)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 666911Fold b.38: Sm-like fold [50181] (3 superfamilies)
    core: barrel, open; n*=4, S*=8; meander; SH3-like topology
  4. 666912Superfamily b.38.1: Sm-like ribonucleoproteins [50182] (5 families) (S)
  5. 667220Family b.38.1.5: LSM14 N-terminal domain-like [141297] (1 protein)
  6. 667221Protein LSM14 homolog A (Lsm14a) [141298] (1 species)
  7. 667222Species Zebrafish (Danio rerio) [TaxId:7955] [141299] (1 PDB entry)
  8. 667223Domain d2fb7a1: 2fb7 A:16-95 [133238]

Details for d2fb7a1

PDB Entry: 2fb7 (more details)

PDB Description: nmr solution structure of protein from zebra fish dr.13312
PDB Compounds: (A:) Sm-like protein, LSm-14_N (RAP55)

SCOP Domain Sequences for d2fb7a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2fb7a1 b.38.1.5 (A:16-95) LSM14 homolog A (Lsm14a) {Zebrafish (Danio rerio) [TaxId: 7955]}
pyigskisliskaeiryegilytidtenstvalakvrsfgtedrptdrpiaprdetfeyi
ifrgsdikdltvceppkpim

SCOP Domain Coordinates for d2fb7a1:

Click to download the PDB-style file with coordinates for d2fb7a1.
(The format of our PDB-style files is described here.)

Timeline for d2fb7a1: