![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
![]() | Superfamily c.47.1: Thioredoxin-like [52833] (24 families) ![]() |
![]() | Family c.47.1.23: Selenoprotein W-related [142411] (4 proteins) Pfam PF05169; "minimalized" version of the thioredoxin-like fold |
![]() | Protein Hypothetical protein Atu0228 [142414] (1 species) |
![]() | Species Agrobacterium tumefaciens [TaxId:358] [142415] (1 PDB entry) Uniprot Q8UIR5 4-89 |
![]() | Domain d2fa8a1: 2fa8 A:4-89 [133185] |
PDB Entry: 2fa8 (more details), 1.9 Å
SCOPe Domain Sequences for d2fa8a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2fa8a1 c.47.1.23 (A:4-89) Hypothetical protein Atu0228 {Agrobacterium tumefaciens [TaxId: 358]} tkpriairyctqcnwllragwmaqeilqtfasdigevslipstgglfeitvdgtiiwerk rdggfpgpkelkqrirdlidperdlg
Timeline for d2fa8a1: