Lineage for d2fa8c_ (2fa8 C:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2876126Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 2876127Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 2878927Family c.47.1.23: Selenoprotein W-related [142411] (4 proteins)
    Pfam PF05169; "minimalized" version of the thioredoxin-like fold
  6. 2878928Protein Hypothetical protein Atu0228 [142414] (1 species)
  7. 2878929Species Agrobacterium tumefaciens [TaxId:358] [142415] (1 PDB entry)
    Uniprot Q8UIR5 4-89
  8. 2878932Domain d2fa8c_: 2fa8 C: [133187]
    automated match to d2fa8a1

Details for d2fa8c_

PDB Entry: 2fa8 (more details), 1.9 Å

PDB Description: Crystal Structure of the Putative Selenoprotein W-related family Protein from Agrobacterium tumefaciens
PDB Compounds: (C:) hypothetical protein Atu0228

SCOPe Domain Sequences for d2fa8c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2fa8c_ c.47.1.23 (C:) Hypothetical protein Atu0228 {Agrobacterium tumefaciens [TaxId: 358]}
etkpriairyctqcnwllragwmaqeilqtfasdigevslipstgglfeitvdgtiiwer
krdggfpgpkelkqrirdlid

SCOPe Domain Coordinates for d2fa8c_:

Click to download the PDB-style file with coordinates for d2fa8c_.
(The format of our PDB-style files is described here.)

Timeline for d2fa8c_: