| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
Superfamily c.47.1: Thioredoxin-like [52833] (24 families) ![]() |
| Family c.47.1.23: Selenoprotein W-related [142411] (4 proteins) Pfam PF05169; "minimalized" version of the thioredoxin-like fold |
| Protein Hypothetical protein Atu0228 [142414] (1 species) |
| Species Agrobacterium tumefaciens [TaxId:358] [142415] (1 PDB entry) Uniprot Q8UIR5 4-89 |
| Domain d2fa8d_: 2fa8 D: [133188] automated match to d2fa8a1 |
PDB Entry: 2fa8 (more details), 1.9 Å
SCOPe Domain Sequences for d2fa8d_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2fa8d_ c.47.1.23 (D:) Hypothetical protein Atu0228 {Agrobacterium tumefaciens [TaxId: 358]}
tetkpriairyctqcnwllragwmaqeilqtfasdigevslipstgglfeitvdgtiiwe
rkrdggfpgpkelkqrirdli
Timeline for d2fa8d_: