Lineage for d2fa1a1 (2fa1 A:85-241)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2611610Fold d.190: Chorismate lyase-like [64287] (1 superfamily)
    duplication of alpha(2)-beta(3) motif; antiparallel beta sheet, order 123654
  4. 2611611Superfamily d.190.1: Chorismate lyase-like [64288] (4 families) (S)
  5. 2611626Family d.190.1.2: UTRA domain [143473] (11 proteins)
    Pfam PF07702
  6. 2611644Protein Probable transcriptional regulator PhnF, receptor domain [143474] (1 species)
  7. 2611645Species Escherichia coli [TaxId:562] [143475] (1 PDB entry)
    Uniprot P16684 84-241
  8. 2611646Domain d2fa1a1: 2fa1 A:85-241 [133182]
    Other proteins in same PDB: d2fa1a2, d2fa1b3
    complexed with bdf

Details for d2fa1a1

PDB Entry: 2fa1 (more details), 1.7 Å

PDB Description: crystal structure of phnf c-terminal domain
PDB Compounds: (A:) Probable transcriptional regulator phnF

SCOPe Domain Sequences for d2fa1a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2fa1a1 d.190.1.2 (A:85-241) Probable transcriptional regulator PhnF, receptor domain {Escherichia coli [TaxId: 562]}
naqarfsqnlldqgshptsekllsvlrpasghvadalgitegenvihlrtlrrvngvalc
lidhyfadltlwptlqrfdsgslhdflreqtgialrrsqtrisarraqakecqrleipnm
spllcvrtlnhrdgesspaeysvsltradmieftmeh

SCOPe Domain Coordinates for d2fa1a1:

Click to download the PDB-style file with coordinates for d2fa1a1.
(The format of our PDB-style files is described here.)

Timeline for d2fa1a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2fa1a2