Lineage for d2fa1a1 (2fa1 A:84-241)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 739492Fold d.190: Chorismate lyase-like [64287] (1 superfamily)
    duplication of alpha(2)-beta(3) motif; antiparallel beta sheet, order 123654
  4. 739493Superfamily d.190.1: Chorismate lyase-like [64288] (2 families) (S)
  5. 739508Family d.190.1.2: UTRA domain [143473] (1 protein)
    Pfam PF07702
  6. 739509Protein Probable transcriptional regulator PhnF, receptor domain [143474] (1 species)
  7. 739510Species Escherichia coli [TaxId:562] [143475] (1 PDB entry)
  8. 739511Domain d2fa1a1: 2fa1 A:84-241 [133182]
    complexed with bdf

Details for d2fa1a1

PDB Entry: 2fa1 (more details), 1.7 Å

PDB Description: crystal structure of phnf c-terminal domain
PDB Compounds: (A:) Probable transcriptional regulator phnF

SCOP Domain Sequences for d2fa1a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2fa1a1 d.190.1.2 (A:84-241) Probable transcriptional regulator PhnF, receptor domain {Escherichia coli [TaxId: 562]}
mnaqarfsqnlldqgshptsekllsvlrpasghvadalgitegenvihlrtlrrvngval
clidhyfadltlwptlqrfdsgslhdflreqtgialrrsqtrisarraqakecqrleipn
mspllcvrtlnhrdgesspaeysvsltradmieftmeh

SCOP Domain Coordinates for d2fa1a1:

Click to download the PDB-style file with coordinates for d2fa1a1.
(The format of our PDB-style files is described here.)

Timeline for d2fa1a1: