SCOP 1.73: Domain d2fa1a1: 2fa1 A:84-241

Lineage for d2fa1a1 (2fa1 A:84-241)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.190: Chorismate lyase-like [64287] (1 superfamily)
   duplication of alpha(2)-beta(3) motif; antiparallel beta sheet, order 123654

4. Superfamily d.190.1: Chorismate lyase-like [64288] (2 families)

5. Family d.190.1.2: UTRA domain [143473] (1 protein)
   Pfam PF07702

6. Protein Probable transcriptional regulator PhnF, receptor domain [143474] (1 species)

7. Species Escherichia coli [TaxId:562] [143475] (1 PDB entry)

8. Domain d2fa1a1: 2fa1 A:84-241 [133182]
   complexed with bdf

Details for d2fa1a1

PDB Entry: 2fa1, 1.7 Å

PDB Description: crystal structure of phnf c-terminal domain

PDB Compounds: (A:) Probable transcriptional regulator phnF

SCOP Domain Sequences for d2fa1a1:

Sequence; same for both SEQRES and ATOM records:

>d2fa1a1 d.190.1.2 (A:84-241) Probable transcriptional regulator PhnF, receptor domain {Escherichia coli [TaxId: 562]}
mnaqarfsqnlldqgshptsekllsvlrpasghvadalgitegenvihlrtlrrvngval
clidhyfadltlwptlqrfdsgslhdflreqtgialrrsqtrisarraqakecqrleipn
mspllcvrtlnhrdgesspaeysvsltradmieftmeh

Timeline for d2fa1a1:

• d2fa1a1 is new in SCOP 1.73
  
• d2fa1a1 appears in SCOP 1.75
  
• d2fa1a1 appears in the current release, SCOPe 2.08