SCOPe 2.08: Domain d2f9hb_: 2f9h B:

Lineage for d2f9hb_ (2f9h B:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.161: PTSIIA/GutA-like [141529] (1 superfamily)
   barrel, closed; n=8, S=12; mixed sheet; two overside connections; duplication: consists of two intertwinned structural repeats

4. Superfamily b.161.1: PTSIIA/GutA-like [141530] (1 family)
   automatically mapped to Pfam PF03829

5. Family b.161.1.1: PTSIIA/GutA-like [141531] (2 proteins)
   Pfam PF03829

6. Protein automated matches [190636] (1 species)
   not a true protein

7. Species Enterococcus faecalis [TaxId:226185] [187692] (1 PDB entry)

8. Domain d2f9hb_: 2f9h B: [133163]
   Other proteins in same PDB: d2f9ha1
   automated match to d2f9ha1

Details for d2f9hb_

PDB Entry: 2f9h, 1.57 Å

PDB Description: The Crystal Structure of PTS System IIA Component from Enterococcus faecalis V583

PDB Compounds: (B:) PTS system, IIA component

SCOPe Domain Sequences for d2f9hb_:

Sequence; same for both SEQRES and ATOM records:

>d2f9hb_ b.161.1.1 (B:) automated matches {Enterococcus faecalis [TaxId: 226185]}
mqatvteigkhaiddsekmiilfgetatdtlkqhaviqsfpekdqvtlaegdhlkigdtn
ytitkvgsfansnlqsiahstlifadaptdeddvirngvyltphqlpkitigttidylv

Timeline for d2f9hb_:

• d2f9hb_ first appeared in SCOP 1.73, called d2f9hb1
  
• d2f9hb_ appears in SCOPe 2.07