SCOP 1.73: Domain d2f9hb1: 2f9h B:5-123

Lineage for d2f9hb1 (2f9h B:5-123)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.161: PTSIIA/GutA-like [141529] (1 superfamily)
   barrel, closed; n=8, S=12; mixed sheet; two overside connections; duplication: consists of two intertwinned structural repeats

4. Superfamily b.161.1: PTSIIA/GutA-like [141530] (1 family)

5. Family b.161.1.1: PTSIIA/GutA-like [141531] (1 protein)
   Pfam PF03829

6. Protein PTS system, IIa component (PTSIIA) [141532] (1 species)

7. Species Enterococcus faecalis [TaxId:1351] [141533] (1 PDB entry)
   EF2603

8. Domain d2f9hb1: 2f9h B:5-123 [133163]
   automatically matched to 2F9H A:3-123

Details for d2f9hb1

PDB Entry: 2f9h, 1.57 Å

PDB Description: The Crystal Structure of PTS System IIA Component from Enterococcus faecalis V583

PDB Compounds: (B:) PTS system, IIA component

SCOP Domain Sequences for d2f9hb1:

Sequence; same for both SEQRES and ATOM records:

>d2f9hb1 b.161.1.1 (B:5-123) PTS system, IIa component (PTSIIA) {Enterococcus faecalis [TaxId: 1351]}
mqatvteigkhaiddsekmiilfgetatdtlkqhaviqsfpekdqvtlaegdhlkigdtn
ytitkvgsfansnlqsiahstlifadaptdeddvirngvyltphqlpkitigttidylv

Timeline for d2f9hb1:

• d2f9hb1 is new in SCOP 1.73
  
• d2f9hb1 appears in SCOP 1.75
  
• d2f9hb1 appears in the current release, SCOPe 2.08, called d2f9hb_