SCOPe 2.08: Domain d2f9ha1: 2f9h A:3-123

Lineage for d2f9ha1 (2f9h A:3-123)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.161: PTSIIA/GutA-like [141529] (1 superfamily)
   barrel, closed; n=8, S=12; mixed sheet; two overside connections; duplication: consists of two intertwinned structural repeats

4. Superfamily b.161.1: PTSIIA/GutA-like [141530] (1 family)
   automatically mapped to Pfam PF03829

5. Family b.161.1.1: PTSIIA/GutA-like [141531] (2 proteins)
   Pfam PF03829

6. Protein PTS system, IIa component (PTSIIA) [141532] (1 species)

7. Species Enterococcus faecalis [TaxId:1351] [141533] (1 PDB entry)
   Uniprot Q831B0 3-123
   EF2603

8. Domain d2f9ha1: 2f9h A:3-123 [133162]
   Other proteins in same PDB: d2f9hb_

Details for d2f9ha1

PDB Entry: 2f9h, 1.57 Å

PDB Description: The Crystal Structure of PTS System IIA Component from Enterococcus faecalis V583

PDB Compounds: (A:) PTS system, IIA component

SCOPe Domain Sequences for d2f9ha1:

Sequence; same for both SEQRES and ATOM records:

>d2f9ha1 b.161.1.1 (A:3-123) PTS system, IIa component (PTSIIA) {Enterococcus faecalis [TaxId: 1351]}
wkmqatvteigkhaiddsekmiilfgetatdtlkqhaviqsfpekdqvtlaegdhlkigd
tnytitkvgsfansnlqsiahstlifadaptdeddvirngvyltphqlpkitigttidyl
v

Timeline for d2f9ha1:

• d2f9ha1 first appeared in SCOP 1.73
  
• d2f9ha1 appears in SCOPe 2.07