Lineage for d2f9ha1 (2f9h A:3-123)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2412885Fold b.161: PTSIIA/GutA-like [141529] (1 superfamily)
    barrel, closed; n=8, S=12; mixed sheet; two overside connections; duplication: consists of two intertwinned structural repeats
  4. 2412886Superfamily b.161.1: PTSIIA/GutA-like [141530] (1 family) (S)
    automatically mapped to Pfam PF03829
  5. 2412887Family b.161.1.1: PTSIIA/GutA-like [141531] (2 protein domains)
    Pfam PF03829
  6. 2412888Protein PTS system, IIa component (PTSIIA) [141532] (1 species)
  7. 2412889Species Enterococcus faecalis [TaxId:1351] [141533] (1 PDB entry)
    Uniprot Q831B0 3-123
    EF2603
  8. 2412890Domain d2f9ha1: 2f9h A:3-123 [133162]
    Other proteins in same PDB: d2f9hb_

Details for d2f9ha1

PDB Entry: 2f9h (more details), 1.57 Å

PDB Description: The Crystal Structure of PTS System IIA Component from Enterococcus faecalis V583
PDB Compounds: (A:) PTS system, IIA component

SCOPe Domain Sequences for d2f9ha1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2f9ha1 b.161.1.1 (A:3-123) PTS system, IIa component (PTSIIA) {Enterococcus faecalis [TaxId: 1351]}
wkmqatvteigkhaiddsekmiilfgetatdtlkqhaviqsfpekdqvtlaegdhlkigd
tnytitkvgsfansnlqsiahstlifadaptdeddvirngvyltphqlpkitigttidyl
v

SCOPe Domain Coordinates for d2f9ha1:

Click to download the PDB-style file with coordinates for d2f9ha1.
(The format of our PDB-style files is described here.)

Timeline for d2f9ha1:

View in 3D
Domains from other chains:
(mouse over for more information)
d2f9hb_