SCOPe 2.08: Domain d2f9bt1: 2f9b T:6-106

Lineage for d2f9bt1 (2f9b T:6-106)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.2: Fibronectin type III [49265] (2 families)

5. Family b.1.2.1: Fibronectin type III [49266] (45 proteins)
   Pfam PF00041

6. Protein Extracellular region of human tissue factor [49267] (2 species)
   tandem of fibronectin type III domains

7. Species Human (Homo sapiens) [TaxId:9606] [49268] (35 PDB entries)
   Uniprot P13726 33-242

8. Domain d2f9bt1: 2f9b T:6-106 [133156]
   Other proteins in same PDB: d2f9bh_, d2f9bl1, d2f9bl2
   automated match to d1o5dt1
   complexed with n1h

Details for d2f9bt1

PDB Entry: 2f9b, 2.54 Å

PDB Description: discovery of novel heterocyclic factor viia inhibitors

PDB Compounds: (T:) tissue factor

SCOPe Domain Sequences for d2f9bt1:

Sequence; same for both SEQRES and ATOM records:

>d2f9bt1 b.1.2.1 (T:6-106) Extracellular region of human tissue factor {Human (Homo sapiens) [TaxId: 9606]}
tvaaynltwkstnfktilewepkpvnqvytvqistksgdwkskcfyttdtecdltdeivk
dvkqtylarvfsypagnvestgsageplyenspeftpylet

Timeline for d2f9bt1:

• d2f9bt1 first appeared in SCOP 1.73
  
• d2f9bt1 appears in SCOPe 2.07