Class b: All beta proteins [48724] (178 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.2: Fibronectin type III [49265] (2 families) |
Family b.1.2.1: Fibronectin type III [49266] (45 proteins) Pfam PF00041 |
Protein Extracellular region of human tissue factor [49267] (2 species) tandem of fibronectin type III domains |
Species Human (Homo sapiens) [TaxId:9606] [49268] (35 PDB entries) Uniprot P13726 33-242 |
Domain d2f9bt1: 2f9b T:6-106 [133156] Other proteins in same PDB: d2f9bh_, d2f9bl1, d2f9bl2 automated match to d1o5dt1 complexed with n1h |
PDB Entry: 2f9b (more details), 2.54 Å
SCOPe Domain Sequences for d2f9bt1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2f9bt1 b.1.2.1 (T:6-106) Extracellular region of human tissue factor {Human (Homo sapiens) [TaxId: 9606]} tvaaynltwkstnfktilewepkpvnqvytvqistksgdwkskcfyttdtecdltdeivk dvkqtylarvfsypagnvestgsageplyenspeftpylet
Timeline for d2f9bt1: