Class b: All beta proteins [48724] (180 folds) |
Fold b.34: SH3-like barrel [50036] (21 superfamilies) barrel, partly opened; n*=4, S*=8; meander the last strand is interrupted by a turn of 3-10 helix |
Superfamily b.34.14: PAZ domain [101690] (2 families) |
Family b.34.14.1: PAZ domain [101691] (6 proteins) |
Protein automated matches [191296] (2 species) not a true protein |
Species Aquifex aeolicus [TaxId:63363] [255166] (2 PDB entries) |
Domain d2f8tb1: 2f8t B:3-314 [133146] Other proteins in same PDB: d2f8ta3, d2f8ta4, d2f8tb3, d2f8tb4 automated match to d1yvua1 protein/RNA complex |
PDB Entry: 2f8t (more details), 3.1 Å
SCOPe Domain Sequences for d2f8tb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2f8tb1 b.34.14.1 (B:3-314) automated matches {Aquifex aeolicus [TaxId: 63363]} keallnlyrieyrpkdttftvfkptheiqkeklnkvrwrvflqtglptfrredefwcagk vekdtlyltlsngeivelkrvgeeefrgfqnerecqelfrdfltktkvkdkfisdfykkf rdkitvqgknrkialipevnekvlkseegyfllhldlkfriqpfetlqtllerndfnpkr irvkpigidfvgrvqdvfkakekgeeffrlcmersthksskkaweellknrelrekaflv vlekgytypatilkpvltyenledeernevadivrmepgkrlnliryilrryvkalrdyg wyispeeerakg
Timeline for d2f8tb1: